PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03111.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 331aa    MW: 38213.5 Da    PI: 4.7073
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03111.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.91.3e-5561331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv +yL +kv+g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat++gyWk
  Rsa1.0_03111.1_g00005.1   6 LPPGFRFHPTDEELVGYYLDRKVNGQTIEL-EIIPEVDLYKCEPWDLPeKsFLPGNDMEWYFYSTRDKKYPNGSRTNRATRAGYWK 90 
                              79****************************.99**************95334455788**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v s k+ ++g+kktLv+y+grap+g +t+Wvmheyrl
  Rsa1.0_03111.1_g00005.1  91 ATGKDRAVES-KKMKMGMKKTLVYYRGRAPHGLRTNWVMHEYRL 133
                              *********9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-633157IPR003441NAC domain
PROSITE profilePS5100559.4596157IPR003441NAC domain
PfamPF023653.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV GYYLDRKVNG QTIELEIIPE VDLYKCEPWD LPEKSFLPGN  60
DMEWYFYSTR DKKYPNGSRT NRATRAGYWK ATGKDRAVES KKMKMGMKKT LVYYRGRAPH  120
GLRTNWVMHE YRLTHLPSSS PSSSIKESYA LCRVFKKQIQ IPKRKDEEMM MGTSVGKEKK  180
EELEEENMWR KCEMERESEE DENLKIASAE TSSSEXERES EEDENLKIAS AETSSSELTQ  240
GILLDEANNS SSFALHFSSS LLDDHDQIFA NDSYLPYYTP LQLQDFPQLS MNEAQIMSID  300
NSKQQDFQCR DSMNGTLDEI FSFSSSATLP L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-57115815169NAC domain-containing protein 19
3swp_C3e-57115815169NAC domain-containing protein 19
3swp_B3e-57115815169NAC domain-containing protein 19
3swp_A3e-57115815169NAC domain-containing protein 19
3swm_D3e-57115815169NAC domain-containing protein 19
3swm_C3e-57115815169NAC domain-containing protein 19
3swm_B3e-57115815169NAC domain-containing protein 19
3swm_A3e-57115815169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1762781e-157AK176278.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-20-J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648357.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI52e-84NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A078BVJ00.0A0A078BVJ0_BRANA; BnaA07g17790D protein
STRINGBra003335.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-146NAC domain containing protein 20